PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc032464.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 59aa    MW: 6925.98 Da    PI: 4.6289
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc032464.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.11.3e-171359148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +ppGfrFhPt+eel+++yL+kk++++k++l +vi+++d++k+ePwd++
  Itr_sc032464.1_g00001.1 13 VPPGFRFHPTEEELLQYYLRKKIASQKIDL-DVIPDIDLNKLEPWDIQ 59
                             69****************************.9*************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-18658IPR003441NAC domain
PROSITE profilePS5100520.2811359IPR003441NAC domain
PfamPF023651.3E-81456IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
MKNLCVNGES QVVPPGFRFH PTEEELLQYY LRKKIASQKI DLDVIPDIDL NKLEPWDIQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878421.15e-28hypothetical protein ARALYDRAFT_907751
SwissprotQ9M2743e-28NAC66_ARATH; NAC domain-containing protein 66
TrEMBLM0Z1R01e-28M0Z1R0_HORVD; Uncharacterized protein
TrEMBLM7ZFU12e-28M7ZFU1_TRIUA; NAC domain-containing protein 43
TrEMBLM8B1A55e-29M8B1A5_TRIUA; NAC domain-containing protein 43
TrEMBLW5I7L73e-29W5I7L7_WHEAT; Uncharacterized protein
STRINGMLOC_75524.14e-27(Hordeum vulgare)
STRINGscaffold_503455.12e-27(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61910.12e-29NAC domain protein 66